Glucagon Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38329

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEF

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glucagon Antibody - BSA Free

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329]

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329]

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329] - Analysis in human pancreas and skeletal muscle tissues. Corresponding GCG RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329]

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329]

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329] - Staining of human colon, pancreas, skeletal muscle and small intestine using Anti-GCG antibody NBP2-38329 (A) shows similar protein distribution across tissues to independent antibody NBP2-38330 (B).
Immunocytochemistry/ Immunofluorescence: Glucagon Antibody [NBP2-38329]

Immunocytochemistry/ Immunofluorescence: Glucagon Antibody [NBP2-38329]

Immunocytochemistry/Immunofluorescence: Glucagon Antibody [NBP2-38329] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329]

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329]

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329]

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329]

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329] - Staining of human pancreas shows strong cytoplasmic positivity in endocrine glandular cells.
Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329]

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329]

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329] - Staining of human small intestine shows strong cytoplasmic positivity in enteroendocrine cells.
Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329]

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329]

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329] - Staining of human colon shows moderate cytoplasmic positivity in enteroendocrine cells.

Applications for Glucagon Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glucagon

The protein encoded by the Glucagon gene is actually a preproprotein that is cleaved into four distinct mature peptides. One ofthese, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulatingglycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signallingpathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promotenutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an activeenteroglucagon. (provided by RefSeq)

Alternate Names

GCG, GRPP

Gene Symbol

GCG

UniProt

Additional Glucagon Products

Product Documents for Glucagon Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glucagon Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glucagon Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glucagon Antibody - BSA Free and earn rewards!

Have you used Glucagon Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...