Haptoglobin Antibody (7C1N2)

Novus Biologicals | Catalog # NBP3-16700

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7C1N2 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 307-406 of human Haptoglobin (P00738). DQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Haptoglobin Antibody (7C1N2)

Western Blot: Haptoglobin Antibody (7C1N2) [NBP3-16700]

Western Blot: Haptoglobin Antibody (7C1N2) [NBP3-16700]

Western Blot: Haptoglobin Antibody (7C1N2) [NBP3-16700] - Western blot analysis of extracts of various cell lines, using Haptoglobin (HP) Rabbit mAb (NBP3-16700) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 10s.
Immunohistochemistry: Haptoglobin Antibody (7C1N2) [NBP3-16700]

Immunohistochemistry: Haptoglobin Antibody (7C1N2) [NBP3-16700]

Immunohistochemistry: Haptoglobin Antibody (7C1N2) [NBP3-16700] - Immunofluorescence analysis of rat liver using Haptoglobin (HP) Rabbit mAb (NBP3-16700) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Haptoglobin Antibody (7C1N2) [NBP3-16700]

Immunohistochemistry-Paraffin: Haptoglobin Antibody (7C1N2) [NBP3-16700]

Immunohistochemistry-Paraffin: Haptoglobin Antibody (7C1N2) [NBP3-16700] - Immunohistochemistry of paraffin-embedded human liver cancer using Haptoglobin (HP) Rabbit mAb (NBP3-16700) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Haptoglobin Antibody (7C1N2)

Immunocytochemistry/ Immunofluorescence: Haptoglobin Antibody (7C1N2) [NBP3-16700] -

Immunocytochemistry/ Immunofluorescence: Haptoglobin Antibody (7C1N2) [NBP3-16700] - Immunofluorescence analysis of paraffin-embedded rat liver using Haptoglobin (HP) Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Haptoglobin Antibody (7C1N2)

Immunocytochemistry/ Immunofluorescence: Haptoglobin Antibody (7C1N2) [Haptoglobin] -

Immunocytochemistry/ Immunofluorescence: Haptoglobin Antibody (7C1N2) [Haptoglobin] - Immunofluorescence analysis of paraffin-embedded rat liver using Haptoglobin (HP) Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Haptoglobin Antibody (7C1N2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Haptoglobin

Haptoglobin combines with free plasma hemoglobin, preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin, while making the hemoglobin accessible to degradative enzymes.

Alternate Names

HP, HP-1, hp2-alpha, HPA1S

Gene Symbol

HP

Additional Haptoglobin Products

Product Documents for Haptoglobin Antibody (7C1N2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Haptoglobin Antibody (7C1N2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Haptoglobin Antibody (7C1N2)

There are currently no reviews for this product. Be the first to review Haptoglobin Antibody (7C1N2) and earn rewards!

Have you used Haptoglobin Antibody (7C1N2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...