IL-2 R beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34148

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IL-2 R beta Antibody - BSA Free

Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148]

Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148]

Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148] - Staining of human kidney shows no postivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148]

Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148]

Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148] - Analysis in human lymph node and kidney tissues. Corresponding IL-2 R beta RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148]

Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148]

Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148] - Staining of human colon shows strong cytoplasmic positivity in lymphocytes.
Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148]

Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148]

Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148] - Staining of human lymph node shows strong cytoplasmic positivity in lymphocytes.
Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148]

Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148]

Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for IL-2 R beta Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IL-2 R beta

The Interleukin 2 Receptor alpha and beta chains, together with the common gamma chain, constitute the high affinity IL2 receptor present on activated T and B cells, thymocyte subset, pre B cells and T regulatory cells. Homodimeric alpha chains result in low affinity receptor, while homodimeric beta chains produce a medium affinity receptor. Normally an integral membrane protein, soluble IL2 Receptor alpha has been isolated and determined to result from extracellular proteolysis. Alternately spliced IL2 Receptor alpha mRNAs have been isolated, but the significance of each is presently unknown.

Long Name

Interleukin 2 Receptor beta

Alternate Names

CD122, IL-15 R beta, IL-2Rb, IL2R beta, IL2RB

Gene Symbol

IL2RB

UniProt

Additional IL-2 R beta Products

Product Documents for IL-2 R beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IL-2 R beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IL-2 R beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IL-2 R beta Antibody - BSA Free and earn rewards!

Have you used IL-2 R beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies