MKK4/MEK4 Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-03652
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse, Rat
Applications
Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 300-399 of human MKK4/MEK4 (NP_003001.1). LATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for MKK4/MEK4 Antibody - BSA Free
Western Blot: MKK4/MEK4 AntibodyBSA Free [NBP3-03652]
Western Blot: MKK4/MEK4 Antibody [NBP3-03652] - Analysis of extracts of various cell lines, using MKK4/MEK4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.Western Blot: MKK4/MEK4 Antibody - BSA Free [NBP3-03652]
Western Blot: MKK4/MEK4 Antibody [NBP3-03652] - Analysis of extracts from normal (control) and MAP2K4 knockout (KO) HeLa cells, using MKK4/MEK4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] -
Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using MKK4/MEK4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] -
Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Immunohistochemistry analysis of paraffin-embedded Rat ovary using MKK4/MEK4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.Western Blot: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] -
Western Blot: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Western blot analysis of lysates from A-549 cells, using MKK4/MEK4 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] -
Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Immunohistochemistry analysis of paraffin-embedded Human colon cancer using MKK4/MEK4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] -
Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Immunohistochemistry analysis of paraffin-embedded Rat lung using MKK4/MEK4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.Western Blot: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] -
Western Blot: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Western blot analysis of various lysates, using MKK4/MEK4 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] -
Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using MKK4/MEK4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.Western Blot: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] -
Western Blot: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Western blot analysis of lysates from HeLa cells, using MKK4/MEK4 Rabbit pAb at 1:700 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Applications for MKK4/MEK4 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50-1:100
Western Blot
1:500-1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: MKK4
Long Name
Mitogen-activated Protein Kinase Kinase 4
Alternate Names
JNKK1, MAP2K4, MAPKK4, MEK4, PRKMK4, SERK1
Gene Symbol
MAP2K4
Additional MKK4 Products
Product Documents for MKK4/MEK4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MKK4/MEK4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for MKK4/MEK4 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review MKK4/MEK4 Antibody - BSA Free and earn rewards!
Have you used MKK4/MEK4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars