MKK4/MEK4 Antibody - BSA Free

Name: MKK4/MEK4 Antibody - BSA Free
Brand: Novus Biologicals
SKU: NBP3-03652
Price: 459 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-03652

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

View all MKK4 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 300-399 of human MKK4/MEK4 (NP_003001.1). LATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MKK4/MEK4 Antibody - BSA Free

Western Blot: MKK4/MEK4 AntibodyBSA Free [NBP3-03652]

Western Blot: MKK4/MEK4 Antibody [NBP3-03652] - Analysis of extracts of various cell lines, using MKK4/MEK4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.

Western Blot: MKK4/MEK4 Antibody - BSA Free [NBP3-03652]

Western Blot: MKK4/MEK4 Antibody [NBP3-03652] - Analysis of extracts from normal (control) and MAP2K4 knockout (KO) HeLa cells, using MKK4/MEK4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] -

Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using MKK4/MEK4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] -

Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Immunohistochemistry analysis of paraffin-embedded Rat ovary using MKK4/MEK4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] -

Western Blot: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Western blot analysis of lysates from A-549 cells, using MKK4/MEK4 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] -

Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Immunohistochemistry analysis of paraffin-embedded Human colon cancer using MKK4/MEK4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] -

Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Immunohistochemistry analysis of paraffin-embedded Rat lung using MKK4/MEK4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] -

Western Blot: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Western blot analysis of various lysates, using MKK4/MEK4 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] -

Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using MKK4/MEK4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] -

Western Blot: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Western blot analysis of lysates from HeLa cells, using MKK4/MEK4 Rabbit pAb at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

View 7 more images

Applications for MKK4/MEK4 Antibody - BSA Free

Application

Recommended Usage

Immunohistochemistry

1:50-1:100

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MKK4

MKK4, also known as JNKK1 and SEK1, is a dual specificity kinase that belongs to the Ser/Thr protein kinase family. MKK4 is a direct activator of MAP kinases in response to various environmental stresses or mitogenic stimuli. MKK4 phosphorylates and activates p38 MAP kinase and JNK but not ERK 1/2 (1-2). JNK is activated by dual phosphorylation at Thr and Tyr by MKK4 and MKK7; although MKK4 will preferentially phosphorylate Tyr (3). MKK4 is also known to be a tumor suppressor, as mutations inactivating the MKK4 gene have been found in 5% of a wide variety of tumor types (4).

Long Name

Mitogen-activated Protein Kinase Kinase 4

Alternate Names

JNKK1, MAP2K4, MAPKK4, MEK4, PRKMK4, SERK1

Gene Symbol

MAP2K4

Additional MKK4 Products

Product Documents for MKK4/MEK4 Antibody - BSA Free

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MKK4/MEK4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.