Myeloperoxidase/MPO Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38922

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GAAPAVLGEVDTSLVLSSMEEAKQLVDKAYKERRESIKQRLR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Myeloperoxidase/MPO Antibody - BSA Free

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922]

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922]

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922] - Analysis in human bone marrow and cerebral cortex tissues using NBP2-38922 antibody. Corresponding Myeloperoxidase/MPO RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922]

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922]

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922] - Staining of human bone marrow, cerebral cortex, liver and testis using Anti-Myeloperoxidase/MPO antibody NBP2-38922 (A) shows similar protein distribution across tissues to independent antibody NBP1-87556 (B).
Western Blot: Myeloperoxidase/MPO Antibody [NBP2-38922]

Western Blot: Myeloperoxidase/MPO Antibody [NBP2-38922]

Western Blot: Myeloperoxidase/MPO Antibody [NBP2-38922] - Analysis in human cell line NB4.
Immunocytochemistry/ Immunofluorescence: Myeloperoxidase/MPO Antibody [NBP2-38922]

Immunocytochemistry/ Immunofluorescence: Myeloperoxidase/MPO Antibody [NBP2-38922]

Immunocytochemistry/Immunofluorescence: Myeloperoxidase/MPO Antibody [NBP2-38922] - Staining of human cell line SiHa shows localization to nucleus & vesicles.
Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922]

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922]

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922]

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922]

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922]

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922]

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922] - Staining of human liver.
Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922]

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922]

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP2-38922] - Staining of human testis.

Applications for Myeloperoxidase/MPO Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Myeloperoxidase/MPO

FUNCTION: Part of the host defense system of polymorphonuclear leukocytes. It is responsible for microbicidal activity against a wide range of organisms. In the stimulated PMN, MPO catalyzes the production of hypohalous acids, primarily hypochlorous acid in physiologic situations, and other toxic intermediates that greatly enhance PMN microbicidal activity. MPO is an important marker for myeloid cells, from the promyelocyte stage and to the mature forms. CATALYTIC ACTIVITY: Donor + H2O2 = oxidized donor + 2 H2O. CATALYTIC ACTIVITY: Cl- + H2O2 = HOCl + 2 H2O. COFACTOR: Binds 1 calcium ion per heterodimer. COFACTOR: Binds 1 heme B (iron-protoporphyrin IX) group covalently per heterodimer. SUBUNIT: Tetramer of two light chains and two heavy chains. SUBCELLULAR LOCATION: Lysosome. ALTERNATIVE PRODUCTS: 3 named isoforms produced by alternative splicing. DISEASE: Defects in MPO are the cause of myeloperoxidase deficiency (MPD). MPD is an autosomal recessive defect that results in disseminated candidiasis. SIMILARITY: Belongs to the peroxidase family. XPO subfamily.

Alternate Names

MPO

Gene Symbol

MPO

UniProt

Additional Myeloperoxidase/MPO Products

Product Documents for Myeloperoxidase/MPO Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Myeloperoxidase/MPO Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Myeloperoxidase/MPO Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Myeloperoxidase/MPO Antibody - BSA Free and earn rewards!

Have you used Myeloperoxidase/MPO Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies