N-Cadherin Antibody (6F9G8)
Novus Biologicals | Catalog # NBP3-15654
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse, Rat
Applications
Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 6F9G8 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human N Cadherin (P19022). AKFLIYAQDKETQEKWQVAVKLSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGP
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for N-Cadherin Antibody (6F9G8)
Western Blot: N-Cadherin Antibody (6F9G8) [NBP3-15654]
Western Blot: N-Cadherin Antibody (6F9G8) [NBP3-15654] - Western blot analysis of extracts from normal (control) and N-Cadherin knockout (KO) HeLa cells, using N-Cadherin antibody (NBP3-15654) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.Immunohistochemistry: N-Cadherin Antibody (6F9G8) [N-Cadherin] -
Immunohistochemistry: N-Cadherin Antibody (6F9G8) [N-Cadherin] - Immunohistochemistry analysis of paraffin-embedded Rat heart tissue using [KO Validated] N-Cadherin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.Immunocytochemistry/ Immunofluorescence: N-Cadherin Antibody (6F9G8) [N-Cadherin] -
Immunocytochemistry/ Immunofluorescence: N-Cadherin Antibody (6F9G8) [N-Cadherin] - Confocal imaging of paraffin-embedded rat heart using [KO Validated] N-Cadherin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.Western Blot: N-Cadherin Antibody (6F9G8) [N-Cadherin] -
Western Blot: N-Cadherin Antibody (6F9G8) [N-Cadherin] - Western blot analysis of lysates from C2C12 cells using [KO Validated] N-Cadherin Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Immunohistochemistry: N-Cadherin Antibody (6F9G8) [N-Cadherin] -
Immunohistochemistry: N-Cadherin Antibody (6F9G8) [N-Cadherin] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using [KO Validated] N-Cadherin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: N-Cadherin Antibody (6F9G8) [N-Cadherin] -
Immunohistochemistry: N-Cadherin Antibody (6F9G8) [N-Cadherin] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using [KO Validated] N-Cadherin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.Immunocytochemistry/ Immunofluorescence: N-Cadherin Antibody (6F9G8) [N-Cadherin] -
Immunocytochemistry/ Immunofluorescence: N-Cadherin Antibody (6F9G8) [N-Cadherin] - Confocal imaging of paraffin-embedded Mouse heart using [KO Validated] N-Cadherin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.Immunohistochemistry: N-Cadherin Antibody (6F9G8) [N-Cadherin] -
Immunohistochemistry: N-Cadherin Antibody (6F9G8) [N-Cadherin] - Immunohistochemistry analysis of paraffin-embedded Mouse heart tissue using [KO Validated] N-Cadherin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.Western Blot: N-Cadherin Antibody (6F9G8) [N-Cadherin] -
Western Blot: N-Cadherin Antibody (6F9G8) [N-Cadherin] - Western blot analysis of lysates from C6 cells using [KO Validated] N-Cadherin Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Applications for N-Cadherin Antibody (6F9G8)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: N-Cadherin
N-cadherin is expressed on multiple cell types but is most highly expressed by mesenchymal cells and neural tissue (2). Functionally, N-cadherin has a number of roles including maintaining structural integrity and adhesion, cell signaling, and formation of neuronal synapses and the vascular wall (2). The cytoplasmic tail interacts with beta-catenin which then binds with alpha-catenin, forming the cadherin-catenin adhesion complex, an important component of adhesions junctions (1-3). Given its role in adhesion, N-cadherin serves as an indicator of epithelial-to-mesenchymal transition (EMT) (1-4). The loss of E-cadherin during EMT corresponds with an increase in N-cadherin expression (1-4). This "cadherin-switch" is associated with increased migratory and invasive behavior observed in tumor progress (1-4). Proteases including activity of a disintegrin and metalloprotease 10 (ADAM10), matrix metalloproteinases (MMPs), caspase 3, presenilin, and calpain can cleave N-cadherin as a mechanism for regulating Wnt/beta-catenin signaling and inducing oncogenic signals (3,4). In addition to its expression in solid tumors, N-cadherin has been indicated in hematological disorders such as leukemia and multiple myeloma (1). N-cadherin antagonists are currently being studied as potential therapeutics for a variety of cancer studies (1-2).
References
1. Mrozik, K. M., Blaschuk, O. W., Cheong, C. M., Zannettino, A., & Vandyke, K. (2018). N-cadherin in cancer metastasis, its emerging role in haematological malignancies and potential as a therapeutic target in cancer. BMC Cancer. https://doi.org/10.1186/s12885-018-4845-0
2. Loh, C. Y., Chai, J. Y., Tang, T. F., Wong, W. F., Sethi, G., Shanmugam, M. K., Chong, P. P., & Looi, C. Y. (2019). The E-Cadherin and N-Cadherin Switch in Epithelial-to-Mesenchymal Transition: Signaling, Therapeutic Implications, and Challenges. Cells. https://doi.org/10.3390/cells8101118
3. Derycke, L. D., & Bracke, M. E. (2004). N-cadherin in the spotlight of cell-cell adhesion, differentiation, embryogenesis, invasion and signalling. The International Journal of Developmental Biology. https://doi.org/10.1387/ijdb.041793ld
4. Yu, W., Yang, L., Li, T., & Zhang, Y. (2019). Cadherin Signaling in Cancer: Its Functions and Role as a Therapeutic Target. Frontiers in Oncology. https://doi.org/10.3389/fonc.2019.00989
5. Unitprot (P1903)
Long Name
Neural Cadherin
Alternate Names
Cadherin-2, CD325, CDH2, NCadherin
Gene Symbol
CDH2
Additional N-Cadherin Products
Product Documents for N-Cadherin Antibody (6F9G8)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for N-Cadherin Antibody (6F9G8)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for N-Cadherin Antibody (6F9G8)
There are currently no reviews for this product. Be the first to review N-Cadherin Antibody (6F9G8) and earn rewards!
Have you used N-Cadherin Antibody (6F9G8)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars