Peroxiredoxin 2 Antibody (4E10-2D2) - Azide and BSA Free

Novus Biologicals | Catalog # H00007001-M01

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Biological Validation

Species Reactivity

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 4E10-2D2

Format

Azide and BSA Free
View all Peroxiredoxin 2 Primary Antibodies »

Product Specifications

Immunogen

PRDX2 (AAH00452, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Localization

Cytoplasmic

Specificity

PRDX2 - peroxiredoxin 2

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Peroxiredoxin 2 Antibody (4E10-2D2) - Azide and BSA Free

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01]

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01]

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 monoclonal antibody (M01), clone 4E10-2D2 Analysis of PRDX2 expression in Hela.
Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01]

Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01]

Immunocytochemistry/Immunofluorescence: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Analysis of monoclonal antibody to PRDX2 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01]

Immunohistochemistry-Paraffin: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01]

Immunohistochemistry-Paraffin: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Analysis of monoclonal antibody to PRDX2 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. Antibody concentration 1 ug/ml.
Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01]

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01]

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Analysis of PRDX2 expression in transfected 293T cell line by PRDX2 monoclonal antibody (M01), clone 4E10-2D2.Lane 1: PRDX2 transfected lysate(21.9 KDa).Lane 2: Non-transfected lysate.
ELISA: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01]

ELISA: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01]

ELISA: Peroxiredoxin 2 Antibody (4E1.0-2D2) [H00007001-M01] - Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Detection limit for recombinant GST tagged PRDX2 is approximately 1ng/ml as a capture antibody.
Knockdown Validated: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01]

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01]

Peroxiredoxin-2-Antibody-4E10-2D2-Knockdown-Validated-H00007001-M01-img0014.jpg
Peroxiredoxin 2 Antibody (4E10-2D2)

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] -

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Expression of PRDX2 or PRDX4 does not affect HIF-1 alpha or HIF-2 alpha protein levelsA. & B. HeLa cells were transfected with EV or vector encoding PRDX2-V5 (A, P2) or PRDX4-V5 (B, P4), & exposed to 20% or 1% O2 for 24 h. WCL was subject to immunoblot assays with antibody against HIF-1 alpha, HIF-2 alpha, V5, or acin. C. HeLa-shSC (sc) & HeLa-shPRDX(2+4) (2+4) cells were exposed to 20% or 1% O2 for 24 h in the presence of doxycycline. WCL was subject to immunoblot assays with antibodies against HIF-1 alpha, HIF-2 alpha, PRDX2, PRDX4, & actin. Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Peroxiredoxin 2 Antibody (4E10-2D2)

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] -

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 knockdown increases PRDX4 protein levels in HeLa cellsHeLa subclones were exposed to 20% or 1% O2 for indicated time. Each WCL was subject to immunoblot assays with the indicated antibodies. SC, scrambled control shRNA. P2, PRDX2 shRNA. Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Peroxiredoxin 2 Antibody (4E10-2D2)

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] -

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Hypoxia induces the nuclear translocation of PRDX2 & PRDX4HeLa cells were transfected with vector encoding PRDX2-V5 (P2) or PRDX4-V5 (P4), or empty vector (EV), & exposed to 20% or 1% O2 for 48 h. Nuclear & cytosolic fractions were isolated & subject to immunoblot assays with antibodies against HIF-1 alpha, HIF-2 alpha, V5, alpha -tubulin, & histone H3. Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Peroxiredoxin 2 Antibody (4E10-2D2)

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] -

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Mapping the PRDX2 & PRDX4 binding domains of HIF-1 alpha A. & B. HeLa cells were transfected with PRDX2-V5 (A) or PRDX4-V5 (B) vector & WCL was incubated with purified GST or GST-HIF-1 alpha fusion protein in the presence of glutathione-Sepharose beads, followed by immunoblot assays with anti-V5 antibody (upper panels) or Ponceau S staining (lower panels). Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Peroxiredoxin 2 Antibody (4E10-2D2)

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] -

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Expression of PRDX2 or PRDX4 does not affect HIF-1 alpha or HIF-2 alpha protein levelsA. & B. HeLa cells were transfected with EV or vector encoding PRDX2-V5 (A, P2) or PRDX4-V5 (B, P4), & exposed to 20% or 1% O2 for 24 h. WCL was subject to immunoblot assays with antibody against HIF-1 alpha, HIF-2 alpha, V5, or acin. C. HeLa-shSC (sc) & HeLa-shPRDX(2+4) (2+4) cells were exposed to 20% or 1% O2 for 24 h in the presence of doxycycline. WCL was subject to immunoblot assays with antibodies against HIF-1 alpha, HIF-2 alpha, PRDX2, PRDX4, & actin. Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Peroxiredoxin 2 Antibody (4E10-2D2)

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] -

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Effect of PRDX2 & PRDX4 on HIF-1 alpha -p300 interactionHeLa cells were transfected with empty vector (EV) or vector encoding PRDX2-V5 or PRDX4-V5, & exposed to 1% O2 for 24 h. WCL was subject to IP with anti-p300 antibody, followed by immunoblot assays using antibodies against HIF-1 alpha, V5, & p300. Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Peroxiredoxin 2 Antibody (4E10-2D2)

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] -

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 expression is regulated by HIF-1 & HIF-2A. HeLa cells were exposed to 20% or 1% O2 for 24 h. RT-qPCR assays were performed using primers specific for the indicated mRNAs. Data are shown as mean ± SEM, n = 3. ***p < 0.001 versus 20% O2. B. HeLa cells were exposed to 20% or 1% O2 for the indicated time. WCLs were subject to immunoblot assays with antibodies against PRDX2, HIF-1 alpha, HIF-2 alpha, & actin. The PRDX2 & actin bands were quantified by densitometry & normalized to 0 h (20% O2). Normalized data are shown as mean ± SEM, n = 3. *p < 0.05, ***p < 0.001 versus 20% O2. C. HeLa-shSC (SC), HeLa-shHIF-1 alpha (1 alpha ), HeLa-shHIF-2 alpha (2 alpha ), & HeLa-sh1 alpha +2 alpha (DKD) cells were exposed to 20% or 1% O2 for 72 h. WCLs were subject to immunoblot assays with antibodies against PRDX2, HIF-1 alpha, HIF-2 alpha, & actin. Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Peroxiredoxin 2 Antibody (4E10-2D2)

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] -

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX proteins bind to HIF-1 alpha & HIF-2 alpha A. HeLa cells were transfected with an expression vector encoding V5-epitope-tagged PRDX2 (PRDX2-V5) & exposed to 1% O2 for 24 h. Whole cell lysate (WCL) was subject to immunoprecipitation (IP) using anti-HIF-1 alpha antibody or control IgG, followed by immunoblot assays with antibody against V5 epitope or HIF-1 alpha. B. HeLa cells were transfected with PRDX2-V5 vector & exposed to 1% O2 for 24 h. The WCL was subject to IP using anti-V5 antibody or control IgG, followed by immunoblot assays with antibody against V5 or HIF-1 alpha. Light IgG: immunoglobulin light chain from the secondary antibody. C. HeLa cells were transfected with vector encoding a V5-tagged PRDX family member & exposed to 1% O2 for 24 h. WCL was subject to IP using anti-HIF-1 alpha antibody, followed by immunoblot assays with antibody against V5 or HIF-1 alpha. D. HeLa cells were transfected with empty vector (EV) or vector encoding a V5-tagged PRDX family member & exposed to 1% O2 for 24 h. WCL was subject to IP using anti-HIF-2 alpha antibody, followed by immunoblot assays with antibody against V5 or HIF-2 alpha. Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Peroxiredoxin 2 Antibody (4E10-2D2)

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] -

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX proteins bind to HIF-1 alpha & HIF-2 alpha A. HeLa cells were transfected with an expression vector encoding V5-epitope-tagged PRDX2 (PRDX2-V5) & exposed to 1% O2 for 24 h. Whole cell lysate (WCL) was subject to immunoprecipitation (IP) using anti-HIF-1 alpha antibody or control IgG, followed by immunoblot assays with antibody against V5 epitope or HIF-1 alpha. B. HeLa cells were transfected with PRDX2-V5 vector & exposed to 1% O2 for 24 h. The WCL was subject to IP using anti-V5 antibody or control IgG, followed by immunoblot assays with antibody against V5 or HIF-1 alpha. Light IgG: immunoglobulin light chain from the secondary antibody. C. HeLa cells were transfected with vector encoding a V5-tagged PRDX family member & exposed to 1% O2 for 24 h. WCL was subject to IP using anti-HIF-1 alpha antibody, followed by immunoblot assays with antibody against V5 or HIF-1 alpha. D. HeLa cells were transfected with empty vector (EV) or vector encoding a V5-tagged PRDX family member & exposed to 1% O2 for 24 h. WCL was subject to IP using anti-HIF-2 alpha antibody, followed by immunoblot assays with antibody against V5 or HIF-2 alpha. Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Peroxiredoxin 2 Antibody (4E10-2D2)

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] -

Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 expression is regulated by HIF-1 & HIF-2A. HeLa cells were exposed to 20% or 1% O2 for 24 h. RT-qPCR assays were performed using primers specific for the indicated mRNAs. Data are shown as mean ± SEM, n = 3. ***p < 0.001 versus 20% O2. B. HeLa cells were exposed to 20% or 1% O2 for the indicated time. WCLs were subject to immunoblot assays with antibodies against PRDX2, HIF-1 alpha, HIF-2 alpha, & actin. The PRDX2 & actin bands were quantified by densitometry & normalized to 0 h (20% O2). Normalized data are shown as mean ± SEM, n = 3. *p < 0.05, ***p < 0.001 versus 20% O2. C. HeLa-shSC (SC), HeLa-shHIF-1 alpha (1 alpha ), HeLa-shHIF-2 alpha (2 alpha ), & HeLa-sh1 alpha +2 alpha (DKD) cells were exposed to 20% or 1% O2 for 72 h. WCLs were subject to immunoblot assays with antibodies against PRDX2, HIF-1 alpha, HIF-2 alpha, & actin. Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Peroxiredoxin 2 Antibody (4E10-2D2) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Knockdown Validated

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Reviewed Applications

Read 1 review rated 5 using H00007001-M01 in the following applications:

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Peroxiredoxin 2

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms. Transcript variants encoding distinct isoforms have been identified for this gene.

Alternate Names

NKEF-B, PRDX2, PRX2, TDPX1, TSA

Entrez Gene IDs

7001 (Human)

Gene Symbol

PRDX2

OMIM

600538 (Human)

UniProt

AAH00452 (Human)

Additional Peroxiredoxin 2 Products

Product Documents for Peroxiredoxin 2 Antibody (4E10-2D2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Peroxiredoxin 2 Antibody (4E10-2D2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers
Oxidative Stress

Citations for Peroxiredoxin 2 Antibody (4E10-2D2) - Azide and BSA Free

Customer Reviews for Peroxiredoxin 2 Antibody (4E10-2D2) - Azide and BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Peroxiredoxin 2 Antibody (4E10-2D2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Name: Corey.
    Application: Western Blot
    Sample Tested: Human HeLa cell lysate
    Species: Human
    Verified Customer | Posted 09/26/2013
    Western Blot analysis of PRDX2 in human HeLa cell lysate
    Peroxiredoxin 2 Antibody (4E10-2D2) - Azide and BSA Free H00007001-M01

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies