PI 3-Kinase p85 beta Antibody (6E2F5)

Name: PI 3-Kinase p85 beta Antibody (6E2F5)
Brand: Novus Biologicals
SKU: NBP3-16493
Price: 389 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-16493

Submit a review

Product Documents

Recombinant Monoclonal Antibody

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6E2F5 expressed in HEK293

View all PI 3-Kinase p85 beta Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human PI 3-Kinase p85 beta (O00459). PRDGAPEPGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALRE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PI 3-Kinase p85 beta Antibody (6E2F5)

Western Blot: PI 3-Kinase p85 beta Antibody (6E2F5) [NBP3-16493]

Western Blot: PI 3-Kinase p85 beta Antibody (6E2F5) [NBP3-16493] - Western blot analysis of extracts of various cell lines, using PI 3-Kinase p85 beta antibody (NBP3-16493) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for PI 3-Kinase p85 beta Antibody (6E2F5)

Application

Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PI 3-Kinase p85 beta

The enzyme phosphatidylinositol 3 kinase (PI3 kinase) is a lipid kinase that generates phosphatidylinositol 3, 4, 5-triphosphate in response to receptor activation in many signal transduction pathways. Class IA PI3Ks exist as a heterodimer of a catalytic 110 kDa (p110) and a regulatory p85 subunit (e.g. p85 beta). p85 beta is an adaptor molecule that regulates the activity of the catalytic p110 subunit by binding to phosphorylated receptor tyrosine kinases (RTKs) through its SH2 domain and mediating the interaction between p110 and the plasma membrane. p85 beta is necessary for insulin-stimulated increase in glucose uptake and glycogen synthesis in insulin-sensitive tissues.

Long Name

Phosphatidylinositol-3-kinase 85 kDa Regulatory Subunit beta

Alternate Names

p85-beta, PI 3Kinase p85 beta, PIK3R2

Gene Symbol

PIK3R2

Additional PI 3-Kinase p85 beta Products

Product Documents for PI 3-Kinase p85 beta Antibody (6E2F5)

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PI 3-Kinase p85 beta Antibody (6E2F5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.