STAT5A Antibody - BSA Free

Name: STAT5A Antibody - BSA Free
Brand: Novus Biologicals
SKU: NBP1-81051
Price: 499 USD
Availability: InStock

Novus Biologicals | Catalog # NBP1-81051

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

View all STAT5a Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit STAT5A Antibody - BSA Free (NBP1-81051) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for STAT5A Antibody - BSA Free

Western Blot: STAT5A Antibody [NBP1-81051]

Western Blot: STAT5A Antibody [NBP1-81051] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/ Immunofluorescence: STAT5A Antibody [NBP1-81051]

Immunocytochemistry/Immunofluorescence: STAT5A Antibody [NBP1-81051] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051]

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in non-germinal center cells.

Western Blot: STAT5A Antibody [NBP1-81051]

Western Blot: STAT5A Antibody [NBP1-81051] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051]

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051] - Staining of human Fallopian tube shows weak cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051]

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051]

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051] - Staining of human liver shows no positivity in hepatocytes as expected.

Chromatin Immunoprecipitation-exo-Seq: STAT5A Antibody - BSA Free [NBP1-81051]

ChIP-Exo-Seq composite graph for Anti-STAT5A (NBP1-81051) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

View 5 more images

Applications for STAT5A Antibody - BSA Free

Application

Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04 - 0.4 ug/ml

Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: STAT5a

Stat5 is part of a 7 protein family known as signal transducer and activator of transcription (STAT) which contributes to signal transduction by cytokine, hormone and growth factor (1). Signal transducer and activator of transcription 5 (Stat5) functions both in signal transduction and activation of transcription. It has been found that cytoplasmic Stat5 is translocated to the nucleus in response to phosphorylation. Stat5 225; tyrosine phosphorylation is activated predominantly by IL2 but also by IL-3, IL-5, IL-7, IL-9, IL-15, G-CSF andGM-CSF(2). Tyrosine phosphorylation is required for DNA-binding activity and dimerization. Serine phosphorylation is also required for maximal transcriptional activity. NCoA-1/SRC-1 acts as a coactivator for both the alpha- and beta-isoforms of Stat5 (3).

Long Name

Signal Transducer and Activator of Transcription 5

Alternate Names

MGF, signal transducer and activator of transcription 5A, STAT5

Entrez Gene IDs

6776 (Human)

Gene Symbol

STAT5A

UniProt

P42229 (Human)

Additional STAT5a Products

Product Documents for STAT5A Antibody - BSA Free

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for STAT5A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.