STAT5A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81051

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for STAT5A Antibody - BSA Free

Western Blot: STAT5A Antibody [NBP1-81051]

Western Blot: STAT5A Antibody [NBP1-81051]

Western Blot: STAT5A Antibody [NBP1-81051] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: STAT5A Antibody [NBP1-81051]

Immunocytochemistry/ Immunofluorescence: STAT5A Antibody [NBP1-81051]

Immunocytochemistry/Immunofluorescence: STAT5A Antibody [NBP1-81051] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051]

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051]

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in non-germinal center cells.
Western Blot: STAT5A Antibody [NBP1-81051]

Western Blot: STAT5A Antibody [NBP1-81051]

Western Blot: STAT5A Antibody [NBP1-81051] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051]

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051]

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051] - Staining of human Fallopian tube shows weak cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051]

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051]

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051]

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051]

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051] - Staining of human liver shows no positivity in hepatocytes as expected.
STAT5A Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: STAT5A Antibody - BSA Free [NBP1-81051]

Chromatin Immunoprecipitation-exo-Seq: STAT5A Antibody - BSA Free [NBP1-81051]

ChIP-Exo-Seq composite graph for Anti-STAT5A (NBP1-81051) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for STAT5A Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: STAT5a

Stat5 is part of a 7 protein family known as signal transducer and activator of transcription (STAT) which contributes to signal transduction by cytokine, hormone and growth factor (1). Signal transducer and activator of transcription 5 (Stat5) functions both in signal transduction and activation of transcription. It has been found that cytoplasmic Stat5 is translocated to the nucleus in response to phosphorylation. Stat5 225; tyrosine phosphorylation is activated predominantly by IL2 but also by IL-3, IL-5, IL-7, IL-9, IL-15, G-CSF andGM-CSF(2). Tyrosine phosphorylation is required for DNA-binding activity and dimerization. Serine phosphorylation is also required for maximal transcriptional activity. NCoA-1/SRC-1 acts as a coactivator for both the alpha- and beta-isoforms of Stat5 (3).

Long Name

Signal Transducer and Activator of Transcription 5

Alternate Names

MGF, signal transducer and activator of transcription 5A, STAT5

Entrez Gene IDs

6776 (Human)

Gene Symbol

STAT5A

UniProt

Additional STAT5a Products

Product Documents for STAT5A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for STAT5A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for STAT5A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review STAT5A Antibody - BSA Free and earn rewards!

Have you used STAT5A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies