STAT6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85345

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This STAT6 antibody was developed against Recombinant Protein corresponding to amino acids: VYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit STAT6 Antibody - BSA Free (NBP1-85345) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for STAT6 Antibody - BSA Free

Western Blot: STAT6 Antibody [NBP1-85345]

Western Blot: STAT6 Antibody [NBP1-85345]

Western Blot: STAT6 Antibody [NBP1-85345] - Analysis in human cell lines A-549 and U-251MG using Anti-STAT6 antibody. Corresponding STAT6 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Immunohistochemistry-Paraffin: STAT6 Antibody [NBP1-85345]

Immunohistochemistry-Paraffin: STAT6 Antibody [NBP1-85345]

Immunohistochemistry-Paraffin: STAT6 Antibody [NBP1-85345] - Staining in human fallopian tube and skeletal muscle tissues using NBP1-85345 antibody. Corresponding STAT6 RNA-seq data are presented for the same tissues.
Simple Western: STAT6 Antibody [NBP1-85345]

Simple Western: STAT6 Antibody [NBP1-85345]

Simple Western: STAT6 Antibody [NBP1-85345] - Simple Western lane view shows a specific band for STAT6 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: STAT6 Antibody [NBP1-85345]

Simple Western: STAT6 Antibody [NBP1-85345]

Simple Western: STAT6 Antibody [NBP1-85345] - Electropherogram image(s) of corresponding Simple Western lane view. STAT6 antibody was used at 1:20 dilution on RT-4 lysate(s).
Immunocytochemistry/ Immunofluorescence: STAT6 Antibody [NBP1-85345]

Immunocytochemistry/ Immunofluorescence: STAT6 Antibody [NBP1-85345]

Immunocytochemistry/Immunofluorescence: STAT6 Antibody [NBP1-85345] - Staining of human cell line U-2 OS shows localization to nuclear membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: STAT6 Antibody [NBP1-85345]

Immunohistochemistry-Paraffin: STAT6 Antibody [NBP1-85345]

Immunohistochemistry-Paraffin: STAT6 Antibody [NBP1-85345] - Staining of human Fallopian tube shows moderate to strong nuclear and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: STAT6 Antibody [NBP1-85345]

Immunohistochemistry-Paraffin: STAT6 Antibody [NBP1-85345]

Immunohistochemistry-Paraffin: STAT6 Antibody [NBP1-85345] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: STAT6 Antibody [NBP1-85345]

Immunohistochemistry-Paraffin: STAT6 Antibody [NBP1-85345]

Immunohistochemistry-Paraffin: STAT6 Antibody [NBP1-85345] - Staining of human skin shows weak to moderate nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: STAT6 Antibody [NBP1-85345]

Immunohistochemistry-Paraffin: STAT6 Antibody [NBP1-85345]

Immunohistochemistry-Paraffin: STAT6 Antibody [NBP1-85345] - Staining of human tonsil shows moderate nuclear and cytoplasmic positivity in non-germinal center cells.

Applications for STAT6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Simple Western

1:20

Western Blot

0.04-0.4 ug/ml
Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:20, apparent MW was 100 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: STAT6

Signal Transducer and Activator of Transcription 6 (STAT6) is a member of the Janus family tyrosine kinases (Jak)/ STAT signal transduction pathway and mediates cytokine signaling by IL 4 and IL-13 (1). STAT6 (predicted molecular weight 94kDa) has been found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL-4. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT6 is tyrosine phosphorylated (Tyr641) in response to cellular interaction with IL-4. STAT6 mRNA has been detected in peripheral blood lymphocytes, colon, intestine, ovary, prostate, thymus, spleen, kidney, liver, lung and placenta. STAT6 is critically involved in Th2 and Th9 immune response (2). Loss of STAT6 impairs IL-4 mediated functions including Th2 helper T cell differentiation, expression of cell surface markers, T-cell proliferation, immunoglobulin class switching to IgE, and partial loss of IL-4 mediated proliferation. Diseases associated with STAT6 include malignant hemangiopericytoma and nut allergies.

References

1. Waqas, S. F. H., Ampem, G., & Roszer, T. (2019). Analysis of IL-4/STAT6 Signaling in Macrophages. Methods Mol Biol, 1966, 211-224. doi:10.1007/978-1-4939-9195-2_17

2. Goenka, S., & Kaplan, M. H. (2011). Transcriptional regulation by STAT6. Immunol Res, 50(1), 87-96. doi:10.1007/s12026-011-8205-2

Long Name

Signal Transducer and Activator of Transcription 6

Alternate Names

D12S1644, EC 2.4.1.227, EC 2.7.7.6, IL-4 Stat, IL-4-STAT, signal transducer and activator of transcription 6, signal transducer and activator of transcription 6, interleukin-4 induced, STAT, interleukin-4 induced, STAT, interleukin4-induced, STAT6B, STAT6C, transcription factor IL-4 STAT

Gene Symbol

STAT6

Additional STAT6 Products

Product Documents for STAT6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for STAT6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for STAT6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review STAT6 Antibody - BSA Free and earn rewards!

Have you used STAT6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies