AMPK beta 2/PRKAB2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92286

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for AMPK beta 2/PRKAB2 Antibody - BSA Free

Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286]

Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286]

Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286] - Analysis in human duodenum and tonsil tissues using NBP1-92286 antibody. Corresponding PRKAB2 RNA-seq data are presented for the same tissues
Western Blot: AMPK beta 2/PRKAB2 Antibody [NBP1-92286]

Western Blot: AMPK beta 2/PRKAB2 Antibody [NBP1-92286]

Western Blot: AMPK beta 2/PRKAB2 Antibody [NBP1-92286] - Analysis in human cell line BEWO.
Immunocytochemistry/ Immunofluorescence: AMPK beta 2/PRKAB2 Antibody [NBP1-92286]

Immunocytochemistry/ Immunofluorescence: AMPK beta 2/PRKAB2 Antibody [NBP1-92286]

Immunocytochemistry/Immunofluorescence: AMPK beta 2/PRKAB2 Antibody [NBP1-92286] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286]

Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286]

Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286]

Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286]

Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286]

Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286]

Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286]

Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286]

Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
AMPK beta 2/PRKAB2 Antibody - BSA Free Immunohistochemistry: AMPK beta 2/PRKAB2 Antibody - BSA Free [NBP1-92286]

Immunohistochemistry: AMPK beta 2/PRKAB2 Antibody - BSA Free [NBP1-92286]

Staining of human tonsil shows no positivity in non-germinal center cells as expected.
AMPK beta 2/PRKAB2 Antibody - BSA Free Immunohistochemistry: AMPK beta 2/PRKAB2 Antibody - BSA Free [NBP1-92286]

Immunohistochemistry: AMPK beta 2/PRKAB2 Antibody - BSA Free [NBP1-92286]

Analysis in human duodenum and tonsil tissues using NBP1-92286 antibody. Corresponding PRKAB2 RNA-seq data are presented for the same tissues.
AMPK beta 2/PRKAB2 Antibody - BSA Free Immunohistochemistry: AMPK beta 2/PRKAB2 Antibody - BSA Free [NBP1-92286]

Immunohistochemistry: AMPK beta 2/PRKAB2 Antibody - BSA Free [NBP1-92286]

Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
AMPK beta 2/PRKAB2 Antibody - BSA Free Immunohistochemistry: AMPK beta 2/PRKAB2 Antibody - BSA Free [NBP1-92286]

Immunohistochemistry: AMPK beta 2/PRKAB2 Antibody - BSA Free [NBP1-92286]

Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
AMPK beta 2/PRKAB2 Antibody - BSA Free Western Blot: AMPK beta 2/PRKAB2 Antibody - BSA Free [NBP1-92286]

Western Blot: AMPK beta 2/PRKAB2 Antibody - BSA Free [NBP1-92286]

Analysis in human cell line BEWO.
AMPK beta 2/PRKAB2 Antibody - BSA Free Immunohistochemistry: AMPK beta 2/PRKAB2 Antibody - BSA Free [NBP1-92286]

Immunohistochemistry: AMPK beta 2/PRKAB2 Antibody - BSA Free [NBP1-92286]

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Applications for AMPK beta 2/PRKAB2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AMPK beta 2

PRKAB2 is encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. [provided by RefSeq]

Long Name

AMP-activated Protein Kinase beta 2

Alternate Names

PRKAB2

Gene Symbol

PRKAB2

Additional AMPK beta 2 Products

Product Documents for AMPK beta 2/PRKAB2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AMPK beta 2/PRKAB2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for AMPK beta 2/PRKAB2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AMPK beta 2/PRKAB2 Antibody - BSA Free and earn rewards!

Have you used AMPK beta 2/PRKAB2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies