beta-Catenin Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-89989
Loading...
Key Product Details
Validated by
Orthogonal Validation, Biological Validation
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Fish
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH
Reactivity Notes
Fish reactivity reported in scientific literature (PMID: 25502575).
Marker
Epithelial Cell Marker, Adherens Junction Marker
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for beta-Catenin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: beta-Catenin Antibody [NBP1-89989]
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody [NBP1-89989] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89989]
Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89989] - Staining of human cervix, uterine shows moderate membranous positivity in squamous epithelial cells.Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89989]
Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89989] - Staining of human skeletal muscle shows weak positivity in myocytes.Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89989]
Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89989] - Staining of human prostate shows moderate membranous positivity in glandular cells.Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89989]
Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89989] - Staining of human duodenum shows moderate membranous positivity in glandular cells.Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89989]
Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89989] - Staining of human pancreas shows moderate membranous positivity in exocrine glandular cells.Western Blot: beta-Catenin Antibody - BSA Free [NBP1-89989]
Analysis in human cell line SW480.Western Blot: beta-Catenin Antibody - BSA Free [NBP1-89989]
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.Western Blot: beta-Catenin Antibody - BSA Free [NBP1-89989] -
Omegaven® inhibits epithelial to mesenchymal transition induced by TGF beta 1.Human liver epithelial cell line THLE-3 was incubated in presence or absence of lipid emulsions Omegaven® 10%, Lipofundin MCT/LCT® 20%, ClinOleic® 20% or SMOFlipid® 20% at different dilutions, for 30 min followed by TGF beta 1 5 ng/mL stimulation for additional 72 hours (A and B) or 25 min (C). (A) Expression of mRNA of ZO-1 and (B) E-cadherin. (C) Phosphorylation of Samd3, ERK1/2 and Akt and nuclear expression of beta -catenin. Representative western blot are showed and quantified in graphic bars. Results are expressed as means +/- SEM of six independent experiments. *p<0.05 related to the control group. #p<0.05 related to the stimulus. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/25502575), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for beta-Catenin Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: beta-Catenin
Additional beta-Catenin Products
Product Documents for beta-Catenin Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for beta-Catenin Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for beta-Catenin Antibody - BSA Free
Customer Reviews for beta-Catenin Antibody - BSA Free
There are currently no reviews for this product. Be the first to review beta-Catenin Antibody - BSA Free and earn rewards!
Have you used beta-Catenin Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...
Associated Pathways
Blood-Brain Barrier Pathway: Anatomy
HIF Enhancer Pathways
Notch Signaling Pathways
Wnt Signaling Pathways: beta-Catenin-dependent Wnt Signaling