Brg1 Antibody (4N9C4)

Novus Biologicals | Catalog # NBP3-15773

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4N9C4 expressed in HEK293
View all Brg1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Brg1 (P51532). LQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

185 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Brg1 Antibody (4N9C4)

Brg1 Antibody (4N9C4)

Western Blot: Brg1 Antibody (4N9C4) [NBP3-15773] -

Western Blot: Brg1 Antibody (4N9C4) [NBP3-15773] - Analysis of lysates from Rat brain using BRG1/SMARCA4 Rabbit mAb at 1:1000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 45s.
Brg1 Antibody (4N9C4)

Western Blot: Brg1 Antibody (4N9C4) [NBP3-15773] -

Western Blot: Brg1 Antibody (4N9C4) [NBP3-15773] - Analysis of lysates from Mouse brain using BRG1/SMARCA4 Rabbit mAb at 1:1000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.
Brg1 Antibody (4N9C4)

Immunohistochemistry-Paraffin: Brg1 Antibody (4N9C4) [NBP3-15773] -

Immunohistochemistry-Paraffin: Brg1 Antibody (4N9C4) [NBP3-15773] - Analysis of paraffin-embedded Human cervix cancer using BRG1/SMARCA4 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Brg1 Antibody (4N9C4)

Immunohistochemistry-Paraffin: Brg1 Antibody (4N9C4) [NBP3-15773] -

Immunohistochemistry-Paraffin: Brg1 Antibody (4N9C4) [NBP3-15773] -Analysis of paraffin-embedded Human colon carcinoma using BRG1/SMARCA4 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Brg1 Antibody (4N9C4)

Immunohistochemistry: Brg1 Antibody (4N9C4) [Brg1] -

Immunohistochemistry: Brg1 Antibody (4N9C4) [Brg1] - Immunohistochemistry analysis of paraffin-embedded Human colon using Brg1 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Brg1 Antibody (4N9C4)

Western Blot: Brg1 Antibody (4N9C4) [Brg1] -

Western Blot: Brg1 Antibody (4N9C4) [Brg1] - Western blot analysis of lysates from HeLa cells using Brg1 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Brg1 Antibody (4N9C4)

Immunohistochemistry: Brg1 Antibody (4N9C4) [Brg1] -

Immunohistochemistry: Brg1 Antibody (4N9C4) [Brg1] - Immunohistochemistry analysis of paraffin-embedded Human endometrium cancer using Brg1 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Brg1 Antibody (4N9C4)

Immunocytochemistry/ Immunofluorescence: Brg1 Antibody (4N9C4) [Brg1] -

Immunocytochemistry/ Immunofluorescence: Brg1 Antibody (4N9C4) [Brg1] - Confocal imaging of NIH-3T3 cells using Brg1 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Brg1 Antibody (4N9C4)

Immunohistochemistry: Brg1 Antibody (4N9C4) [Brg1] -

Immunohistochemistry: Brg1 Antibody (4N9C4) [Brg1] - Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma using Brg1 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Brg1 Antibody (4N9C4)

Immunohistochemistry: Brg1 Antibody (4N9C4) [Brg1] -

Immunohistochemistry: Brg1 Antibody (4N9C4) [Brg1] - Immunohistochemistry analysis of paraffin-embedded Human placenta using Brg1 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for Brg1 Antibody (4N9C4)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:100 - 1:800

Immunohistochemistry

1:100 - 1:500

Immunohistochemistry-Paraffin

1:100 - 1:500

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Brg1

BRG1 is encoded by this gene is a member of the SWI/SNF family of proteins and is similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. In addition, this protein can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. Alternatively spliced transcripts have been found for this gene, but their full-length natures have not been determined.

Long Name

BRM/SWI2-related gene 1

Alternate Names

SMARCA4, SNF2, SNF2-beta, SNF2L4, SNF2LB, SWI2

Gene Symbol

SMARCA4

Additional Brg1 Products

Product Documents for Brg1 Antibody (4N9C4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Brg1 Antibody (4N9C4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Brg1 Antibody (4N9C4)

There are currently no reviews for this product. Be the first to review Brg1 Antibody (4N9C4) and earn rewards!

Have you used Brg1 Antibody (4N9C4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies