NFkB1 (NFkB p50) and NFkB2 (NFkB p52) are class I members of the Rel/NFkB family of transcription factors that also includes RelA, c-Rel and RelB. Rel/NFkB members regulate expression of genes that participate in immune, apoptotic and oncogenic processes. Class I members lack a C-terminal transcriptional activation segment found in class II members, but contain an RHD (Rel homology domain) that mediates DNA binding, nuclear localization and dimerization. NFkB1 and NFkB2 105 and 100 kDa precursors are proteolytically cleaved to 50 and 52 kDa active subunits, respectively. NFkB is predominantly localized in the cytoplasm as a complex with inhibitory IkB proteins and is released and translocated to the nucleus after phosphorylation of IkB.
NFkB2/NFkB p100 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-87760
Loading...
Key Product Details
Validated by
Knockout/Knockdown, Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human
Predicted:
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western, Knockdown Validated
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for NFkB2/NFkB p100 Antibody - BSA Free
Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760]
Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining in human appendix and skeletal muscle tissues using anti-NFKB2 antibody. Corresponding NFKB2 RNA-seq data are presented for the same tissues.Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-NFKB2 antibody NBP1-87760 (A) shows similar protein distribution across tissues to independent antibody NBP1-87759 (B).Immunocytochemistry/ Immunofluorescence: NFkB2/NFkB p100 Antibody [NBP1-87760]
Immunocytochemistry/Immunofluorescence: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human testis.Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human appendix shows high expression.Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human skeletal muscle shows low expression as expected.Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human kidney.Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human lymph node.Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human cerebral cortex.Simple Western: NFkB2/NFkB p100 Antibody [NBP1-87760]
Simple Western: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Simple Western lane view shows a specific band for NFKB2 in 0.2 mg/ml of RT4 lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.Simple Western: NFkB2/NFkB p100 Antibody [NBP1-87760]
Simple Western: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Electropherogram image(s) of corresponding Simple Western lane view. NFkB p100/p52 antibody was used at 1:30 dilution on RT4 lysate(s).Western Blot: NFkB2/NFkB p100 Antibody - BSA Free [NBP1-87760] -
Knockdown of RXFP1 (a, c, l) by specific siRNA significantly inhibited the expression of PI3K (a, d), phosphorylated Akt (a, e), and TNFAIP3 (a, f) on the first day after intracerebroventricular injections. However, the expression of phosphorylated NF-kappa B (a, g) and inflammatory factors chymase (a, h), tryptase (a, i), IL-6 (a, j), and TNF-alpha (a, k) increased on the first day after GMH. *P < 0.05, Sham vs. RXFP1 SiRNA, #P < 0.05, GMH + vehicle vs. rh-relaxin-2, $P < 0.05, Scr SiRNA vs. RXFP1 SiRNA, one-way ANOVA, Tukey’s test, n = 6 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/32859236), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: NFkB2/NFkB p100 Antibody - BSA Free [NBP1-87760] -
LY294002 significantly decreased PI3K (a, d, l), phosphorylated Akt (a, e), and TNFAIP3 (a, f) expression, which was accompanied by the increase of phosphorylated NF-kappa B (a, g), chymase (a, h), tryptase (a, i), IL-6 (a, j), and TNF-alpha (a, k) on the first day after GMH. *P < 0.05, Sham vs. LY294002; #P > 0.05, GMH + vehicle vs. LY294002; $P < 0.05, DMSO vs. LY294002, one-way ANOVA, Tukey’s test, n = 6 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/32859236), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for NFkB2/NFkB p100 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:500 - 1:1000
Simple Western
1:30
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT4, separated by Size, antibody dilution of 1:30, apparent MW was 134 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT4, separated by Size, antibody dilution of 1:30, apparent MW was 134 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: NFkB2
Long Name
Nuclear Factor Kappa-B, Subunit 2
Alternate Names
LYT10, NF-kB2
Gene Symbol
NFKB2
Additional NFkB2 Products
Product Documents for NFkB2/NFkB p100 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for NFkB2/NFkB p100 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for NFkB2/NFkB p100 Antibody - BSA Free
Customer Reviews for NFkB2/NFkB p100 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review NFkB2/NFkB p100 Antibody - BSA Free and earn rewards!
Have you used NFkB2/NFkB p100 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...
Associated Pathways
Pathogen or Damage-activated C-Type Lectin Receptor Signaling Pathways
TGF-beta Signaling Pathways
Toll-Like Receptor Signaling Pathways