NFkB2/NFkB p100 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87760

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (92%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western, Knockdown Validated

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NFkB2/NFkB p100 Antibody - BSA Free

Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760]

Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760]

Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining in human appendix and skeletal muscle tissues using anti-NFKB2 antibody. Corresponding NFKB2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-NFKB2 antibody NBP1-87760 (A) shows similar protein distribution across tissues to independent antibody NBP1-87759 (B).
Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760]

Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760]

Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Analysis using Anti-NFKB2 antibody NBP1-87760 (A) shows similar pattern to independent antibody NBP1-87759 (B).
Immunocytochemistry/ Immunofluorescence: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunocytochemistry/ Immunofluorescence: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunocytochemistry/Immunofluorescence: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human testis.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human kidney.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human lymph node.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760]

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human cerebral cortex.
Simple Western: NFkB2/NFkB p100 Antibody [NBP1-87760]

Simple Western: NFkB2/NFkB p100 Antibody [NBP1-87760]

Simple Western: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Simple Western lane view shows a specific band for NFKB2 in 0.2 mg/ml of RT4 lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.
Simple Western: NFkB2/NFkB p100 Antibody [NBP1-87760]

Simple Western: NFkB2/NFkB p100 Antibody [NBP1-87760]

Simple Western: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Electropherogram image(s) of corresponding Simple Western lane view. NFkB p100/p52 antibody was used at 1:30 dilution on RT4 lysate(s).
NFkB2/NFkB p100 Antibody - BSA Free

Western Blot: NFkB2/NFkB p100 Antibody - BSA Free [NBP1-87760] -

Knockdown of RXFP1 (a, c, l) by specific siRNA significantly inhibited the expression of PI3K (a, d), phosphorylated Akt (a, e), and TNFAIP3 (a, f) on the first day after intracerebroventricular injections. However, the expression of phosphorylated NF-kappa B (a, g) and inflammatory factors chymase (a, h), tryptase (a, i), IL-6 (a, j), and TNF-alpha (a, k) increased on the first day after GMH. *P < 0.05, Sham vs. RXFP1 SiRNA, #P < 0.05, GMH + vehicle vs. rh-relaxin-2, $P < 0.05, Scr SiRNA vs. RXFP1 SiRNA, one-way ANOVA, Tukey’s test, n = 6 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/32859236), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NFkB2/NFkB p100 Antibody - BSA Free

Western Blot: NFkB2/NFkB p100 Antibody - BSA Free [NBP1-87760] -

LY294002 significantly decreased PI3K (a, d, l), phosphorylated Akt (a, e), and TNFAIP3 (a, f) expression, which was accompanied by the increase of phosphorylated NF-kappa B (a, g), chymase (a, h), tryptase (a, i), IL-6 (a, j), and TNF-alpha (a, k) on the first day after GMH. *P < 0.05, Sham vs. LY294002; #P > 0.05, GMH + vehicle vs. LY294002; $P < 0.05, DMSO vs. LY294002, one-way ANOVA, Tukey’s test, n = 6 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/32859236), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for NFkB2/NFkB p100 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:500 - 1:1000

Simple Western

1:30

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT4, separated by Size, antibody dilution of 1:30, apparent MW was 134 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NFkB2

NFkB1 (NFkB p50) and NFkB2 (NFkB p52) are class I members of the Rel/NFkB family of transcription factors that also includes RelA, c-Rel and RelB. Rel/NFkB members regulate expression of genes that participate in immune, apoptotic and oncogenic processes. Class I members lack a C-terminal transcriptional activation segment found in class II members, but contain an RHD (Rel homology domain) that mediates DNA binding, nuclear localization and dimerization. NFkB1 and NFkB2 105 and 100 kDa precursors are proteolytically cleaved to 50 and 52 kDa active subunits, respectively. NFkB is predominantly localized in the cytoplasm as a complex with inhibitory IkB proteins and is released and translocated to the nucleus after phosphorylation of IkB.

Long Name

Nuclear Factor Kappa-B, Subunit 2

Alternate Names

LYT10, NF-kB2

Gene Symbol

NFKB2

Additional NFkB2 Products

Product Documents for NFkB2/NFkB p100 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NFkB2/NFkB p100 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NFkB2/NFkB p100 Antibody - BSA Free

Customer Reviews for NFkB2/NFkB p100 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NFkB2/NFkB p100 Antibody - BSA Free and earn rewards!

Have you used NFkB2/NFkB p100 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies