PI 3-Kinase p110 delta Antibody (3J0F6)

Novus Biologicals | Catalog # NBP3-15889

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3J0F6 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PI 3-Kinase p110 delta (O00329). EESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PI 3-Kinase p110 delta Antibody (3J0F6)

Western Blot: PI 3-Kinase p110 delta Antibody (3J0F6) [NBP3-15889]

Western Blot: PI 3-Kinase p110 delta Antibody (3J0F6) [NBP3-15889]

Western Blot: PI 3-Kinase p110 delta Antibody (3J0F6) [NBP3-15889] - Western blot analysis of extracts of Mouse thymus, using PI 3-Kinase p110 delta Rabbit mAb (NBP3-15889) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody (3J0F6) [NBP3-15889]

Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody (3J0F6) [NBP3-15889]

Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody (3J0F6) [NBP3-15889] - Immunohistochemistry of paraffin-embedded mouse spleen using PI 3-Kinase p110 delta Rabbit mAb (NBP3-15889) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody (3J0F6) [NBP3-15889]

Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody (3J0F6) [NBP3-15889]

Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody (3J0F6) [NBP3-15889] - Immunohistochemistry of paraffin-embedded rat spleen using PI 3-Kinase p110 delta Rabbit mAb (NBP3-15889) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for PI 3-Kinase p110 delta Antibody (3J0F6)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PI 3-Kinase p110 delta

PI3-Kinases (PI3-Ks) are a family of lipid kinases that are implicated in signal transduction. PI3-K consists of two subunits; p85 and p110. The p85 subunit localize PI3-K activity to the plasma membrane while the p110 subunit contains the catalytic domain of PI3-K. Four isoforms of p110 has been found; the alpha, beta, gamma, and the delta subunit. The delta isoform is predominantly expressed in leukocytes and has been shown to interact with p85 and GTP-bound Ras via its SH2/SH3 domain.

Long Name

Protein Tyrosine Phosphatase 1D

Alternate Names

PI 3Kinase p110 delta, PIK3CD

Gene Symbol

PIK3CD

Additional PI 3-Kinase p110 delta Products

Product Documents for PI 3-Kinase p110 delta Antibody (3J0F6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PI 3-Kinase p110 delta Antibody (3J0F6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PI 3-Kinase p110 delta Antibody (3J0F6)

There are currently no reviews for this product. Be the first to review PI 3-Kinase p110 delta Antibody (3J0F6) and earn rewards!

Have you used PI 3-Kinase p110 delta Antibody (3J0F6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies