GSK-3 beta Antibody - BSA Free

Name: GSK-3 beta Antibody - BSA Free
Brand: Novus Biologicals
SKU: NBP3-02983
Price: 389 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-02983

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

View all GSK-3 beta Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 320-420 of human GSK-3 beta (NP_001139628.1). LLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GSK-3 beta Antibody - BSA Free

Western Blot: GSK-3 beta AntibodyAzide and BSA Free [NBP3-02983]

Western Blot: GSK-3 beta Antibody [NBP3-02983] - Analysis of extracts of various cell lines, using GSK-3 beta antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Kit.

Western Blot: GSK-3 beta AntibodyAzide and BSA Free [NBP3-02983]

Western Blot: GSK-3 beta Antibody [NBP3-02983] - Analysis of 200ug extracts of 22Rv1 cells, using GSK-3 beta antibody. Western blot was performed from the immunoprecipitate using this antibody.

Applications for GSK-3 beta Antibody - BSA Free

Application

Recommended Usage

Immunoprecipitation

1:50 - 1:100

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GSK-3 beta

Glycogen synthase kinase 3beta (GSK-3 beta) is a Serine/Threonine protein kinas involved in the insulin and wingless pathways (1-2). Originally identified as a regulator of glycogen synthase, it has been shown to regulate a diverse array of cellular functions. GSK-3 beta activity is down regulated by phosphorylation on Serine 9 by PKB, or activated by phosphorylation on Tyrosine 216. Once activated, the protein can phosphorylate p53, c-jun, heat shock factor-1 and cyclin D1 (3-4). It is also known to phosphorylate Tau in Allzheimer's disease. Additionally, increased GSK-3 beta protein levels are found in Alzheimer's disease brains.

Long Name

Glycogen Synthase Kinase 3 beta

Alternate Names

GSK3 beta, GSK3B

Gene Symbol

GSK3B

Additional GSK-3 beta Products

Product Documents for GSK-3 beta Antibody - BSA Free

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GSK-3 beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov