B-Raf Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-89942
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for B-Raf Antibody - BSA Free
Immunohistochemistry-Paraffin: B-Raf Antibody [NBP1-89942]
Immunohistochemistry-Paraffin: B-Raf Antibody [NBP1-89942] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.Immunohistochemistry-Paraffin: B-Raf Antibody [NBP1-89942]
Immunohistochemistry-Paraffin: B-Raf Antibody [NBP1-89942] - Staining of human colorectal cancer shows moderate cytoplasmic positivity in tumor cells.Immunohistochemistry-Paraffin: B-Raf Antibody [NBP1-89942]
Immunohistochemistry-Paraffin: B-Raf Antibody [NBP1-89942] - Staining of human kidney shows moderate cytoplasmic positivity in distal tubules.Immunohistochemistry-Paraffin: B-Raf Antibody [NBP1-89942]
Immunohistochemistry-Paraffin: B-Raf Antibody [NBP1-89942] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.Western Blot: B-Raf Antibody - BSA Free [NBP1-89942]
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.Western Blot: B-Raf Antibody [NBP1-89942] -
Western Blot: B-Raf Antibody [NBP1-89942] - Highly efficient wild-type down-regulation & concomitant mutant complementation for BRAF, HRAS & SHP2 proteins by TEMTAC.(a) Expression & phenotype analysis of BRAF V600E & WT in HEK293 cells is shown. Left panel: Western blot results using specific antibodies as indicated. Right panel: MEKp quantification after intensity analysis using ImageJ. (b) Expression & phenotype analysis of HRAS G12V & WT in HEK293 cells. Left panel: Western blot results using antibodies as indicated. Right panel: MEKp quantification after intensity analysis using ImageJ. (c) Expression & phenotype analysis of SHP2 C459G, D61G & WT in GH-HEK293 cells (HEK293 cells stably expressing the growth hormone receptor). Left panel: Western blot results using antibodies as indicated. Right panel: ERKp quantification after intensity analysis using ImageJ. The dashed line indicates that the blot has been cropped. The full blot is provided in Supplementary Figure S11. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/26612112), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: B-Raf Antibody - BSA Free [NBP1-89942]
Analysis in human cell line MOLT-4.Simple Western: B-Raf Antibody [NBP1-89942]
Simple Western: B-Raf Antibody [NBP1-89942] - Simple Western lane view shows a specific band for BRAF in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.Simple Western: B-Raf Antibody [NBP1-89942]
Simple Western: B-Raf Antibody [NBP1-89942] - Electropherogram image(s) of corresponding Simple Western lane view. B-Raf antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).Applications for B-Raf Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Simple Western
1:20
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 96 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 96 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: B-Raf
Long Name
v-Raf Murine Sarcoma Viral Oncogene Homolog B1
Alternate Names
BRaf, BRAF1, RAFB1
Gene Symbol
BRAF
Additional B-Raf Products
Product Documents for B-Raf Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for B-Raf Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for B-Raf Antibody - BSA Free
Customer Reviews for B-Raf Antibody - BSA Free
There are currently no reviews for this product. Be the first to review B-Raf Antibody - BSA Free and earn rewards!
Have you used B-Raf Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...
Associated Pathways
IL-9 Signaling Pathways
IL-15 Signaling Pathways
IL-21 Signaling Pathways
MAPK Signaling: Oxidative Stress Pathway
MAPK Signaling Pathway: Mitogen Stimulation Pathway
mTOR Signaling Pathway
TGF-beta Signaling Pathways
VEGF - VEGF R2 Signaling Pathways