Human Ubiquitin/Ubiquitin+1 Antibody

(1 citations)   
  • Species Reactivity
    Human
  • Specificity
    Detects human Ubiquitin/Ubiquitin+1 in Western blots..
  • Source
    Monoclonal Mouse IgG2B Clone # 83406
  • Purification
    Protein A or G purified from hybridoma culture supernatant
  • Immunogen
    Human Ubiquitin+1 synthetic peptide
    SSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQ LEDGRTLSDYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGSGAQ
  • Formulation
    Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 µm filtered solution in PBS.
  • Label
    Unconjugated
Applications
  •  
    Recommended
    Concentration
    Sample
  • Western Blot
    1-2 µg/mL
    See below
  • Immunohistochemistry
    8-25 µg/mL
    See below
Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.
Data Examples
Immunohistochemistry
Ubiquitin/Ubiquitin+1 in Human Alzheimer's Disease Brain. Ubiquitin/Ubiquitin+1 was detected in immersion fixed paraffin-embedded sections of human Alzheimer's disease brain (cortex) using 25 µg/mL Mouse Anti-Human Ubiquitin/
Ubiquitin+1 Monoclonal Antibody (Catalog # MAB701) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of neurons in the cortex. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Detection of Human Ubiquitin/Ubiquitin+1 by Western Blot. Western blot shows samples of Recombinant Human Ubiquitin (Catalog # 701-UB) (2, 1, and 0.5 ng) and Recombinant Human Ubiquitin+1 (Catalog # 703-UB) (2, 1, and 0.5 ng). PVDF membrane was probed with 1-2 µg/mL Mouse Anti-Human Ubiquitin/Ubiquitin+1 Monoclonal Antibody (Catalog # MAB701) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands for Ubiquitin and Ubiquitin+1 were detected at approximately 11 kDa and 13 kDa, respectively (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 9.
Preparation and Storage
  • Reconstitution
    Reconstitute at 0.5 mg/mL in sterile PBS.
  • Shipping
    The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below. *Small pack size (SP) is shipped with polar packs. Upon receipt, store it immediately at -20 to -70 °C
  • Stability & Storage
    Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
    • 12 months from date of receipt, -20 to -70 °C as supplied.
    • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
    • 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Background: Ubiquitin/Ubiquitin+1

Ubiquitin+1 has a carboxyl terminal amino acid sequence that differs from normal Ubiquitin. The different carboxyl terminal sequence appears to result from a frameshift in the Ubiquitin mRNA. The underlying mechanisms creating the mRNA frameshift are not clearly understood. The occurrence of the frameshift that generates Ubiquitin+1 is much more prevalent in patients with Alzheimers Disease or with Down Syndrome than in control individuals who are not afflicted with the disorders. The monoclonal anti-Ubiquitin+1 (Catalog # MAB703) and rabbit polyclonal anti-Ubiquitin+1 (Catalog # AF703) antibodies were raised against the Ubiquitin+1 carboxyl terminal sequence that differs from normal Ubiquitin and are therefore non-reactive with Ubiquitin. Monoclonal anti-Ubiquitin (Catalog # MAB701) detects both Ubiquitin and Ubiquitin+1 indicating that the epitope recognized by this antibody is contained in the portion of the proteins that are identical.

  • Long Name:
    frame shift mutant
  • Entrez Gene IDs:
    7314 (Human); 298693 (Rat)
  • Alternate Names:
    Ubiquitin/Ubiquitin+1
Related Research Areas
Citations:

R&D Systems personnel manually curate a database that contains references using R&D Systems products. The data collected includes not only links to publications in PubMed, but also provides information about sample types, species, and experimental conditions.

1 Citations: Showing 1 - 1

  1. Ubiquitin as potential cerebrospinal fluid marker of Creutzfeldt-Jakob disease.
    Authors: Steinacker P, Rist W, Swiatek-de-Lange M, Lehnert S, Jesse S, Pabst A, Tumani H, von Arnim CA, Mitrova E, Kretzschmar HA, Lenter M, Wiltfang J, Otto M
    Proteomics, 2010;10(1):81-9.
    Species: Human
    Sample Type: CSF
    Application: WB
Cell and Tissue Staining Kits
Description Application Cat# Citations Images  

Anti-Mouse HRP-DAB Cell & Tissue Staining Kit

CTS002 14
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....
Immunohistochemistry Reagents
Description Application Cat# Citations Images  

Antigen Retrieval Reagent-Universal

CTS015 10
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Antigen Retrieval Reagent-Basic

CTS013 4
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mounting Medium

CTS011 4
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Antigen Retrieval Reagent Sampler (50 mL each)

CTS016
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Antigen Retrieval Reagent-Acidic

CTS014
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

NorthernLights Guard Mounting Media

NL996
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

VisUCyte Antigen Retrieval Reagent-Acidic

VCTS022
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

VisUCyte Antigen Retrieval Reagent-Basic

VCTS021
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

VisUCyte Antigen Retrieval Reagent-Universal

VCTS023
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....
Isotype Controls
Description Application Cat# Citations Images  

Mouse IgG2B Isotype Control

Ctrl MAB004 32  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse IgG2B Isotype Control

Ctrl MAB0041 7  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse IgG2B Isotype Control

Ctrl MAB0042 6
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....
Secondary Antibodies
Description Application Cat# Citations Images  

Mouse IgG HRP-conjugated Antibody

WB HAF007 26  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse F(ab)2 IgG (H+L) PE-conjugated Antibody

Flow F0102B 10  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Donkey Anti-Mouse IgG NorthernLights™ NL557-conjugate Antibody

Flow, IHC, ICC NL007 9
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Donkey Anti-Mouse IgG Biotinylated Antibody

WB BAF018 1
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse IgG HRP-conjugated Antibody

WB HAF018 9  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Donkey Anti-Mouse IgG NorthernLights™ NL637-conjugated Antibody

Flow, IHC, ICC NL008 8
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse F(ab)2 IgG (H+L) APC-conjugated Antibody

Flow F0101B 2  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Donkey Anti-Mouse IgG NorthernLights™ NL493-conjugated Antibody

Flow, IHC, ICC NL009 5
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse F(ab)2 IgG (H+L) Fluorescein-conjugated Antibody

Flow F0103B 5  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse IgG Antibody

WB AF007 4
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Goat Anti-Mouse IgG Biotinylated Antibody

WB BAF007 4
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse/Rabbit IgG VisUCyte HRP Polymer Antibody

IHC VC002  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Rat Anti-Mouse IgG2B APC-conjugated Antibody

Flow F0133 1  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse IgG VisUCyte HRP Polymer Antibody

IHC VC001  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Goat Anti-Mouse IgG Fc Affinity Purified Polyclonal Ab

G-202-C 2
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse F(ab)2 IgG (H+L) PerCP-conjugated Antibody

Flow F0114  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Rat Anti-Mouse IgG2B PE-conjugated Antibody

Flow F0132  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse IgG2B Antibody

Flow MAB0043  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Rat Anti-Mouse IgG2B Fluorescein-conjugated Antibody

Flow F0134 1
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Have you used Human Ubiquitin/Ubiquitin+1 Antibody?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Order Details

Contact Information

Calculators

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷
R&D Systems Guarantee

Monoclonal
Antibody
Panels For
Screening

Learn More
Monoclonal Antibodies

Feedback

Customer Information