Ubiquitin+1 has a carboxyl terminal amino acid sequence that differs from normal Ubiquitin. The different carboxyl terminal sequence appears to result from a frameshift in the Ubiquitin mRNA. The underlying mechanisms creating the mRNA frameshift are not clearly understood. The occurrence of the frameshift that generates Ubiquitin+1 is much more prevalent in patients with Alzheimers Disease or with Down Syndrome than in control individuals who are not afflicted with the disorders. The monoclonal anti-Ubiquitin+1 (Catalog # MAB703) and rabbit polyclonal anti-Ubiquitin+1 (Catalog # AF703) antibodies were raised against the Ubiquitin+1 carboxyl terminal sequence that differs from normal Ubiquitin and are therefore non-reactive with Ubiquitin. Monoclonal anti-Ubiquitin (Catalog # MAB701) detects both Ubiquitin and Ubiquitin+1 indicating that the epitope recognized by this antibody is contained in the portion of the proteins that are identical.
Human Ubiquitin/Ubiquitin+1 Antibody (83406)
R&D Systems | Catalog # MAB701
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2B Clone # 83406
Loading...
Product Specifications
Immunogen
Human Ubiquitin+1 synthetic peptide
SSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQ LEDGRTLSDYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGSGAQ
SSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQ LEDGRTLSDYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGSGAQ
Specificity
Detects human Ubiquitin/Ubiquitin+1 in Western blots..
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2B
Scientific Data Images for Human Ubiquitin/Ubiquitin+1 Antibody (83406)
Ubiquitin/Ubiquitin+1 in Human Alzheimer's Disease Brain.
Ubiquitin/Ubiquitin+1 was detected in immersion fixed paraffin-embedded sections of human Alzheimer's disease brain (cortex) using 25 µg/mL Mouse Anti-Human Ubiquitin/ Ubiquitin+1 Monoclonal Antibody (Catalog # MAB701) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter-stained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of neurons in the cortex. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.Detection of Human Ubiquitin/Ubiquitin+1 by Western Blot.
Western blot shows samples of Recombinant Human Ubiquitin (Catalog # 701-UB) (2, 1, and 0.5 ng) and Recombinant Human Ubiquitin+1 (Catalog # 703-UB) (2, 1, and 0.5 ng). PVDF membrane was probed with 1-2 µg/mL Mouse Anti-Human Ubiquitin/Ubiquitin+1 Monoclonal Antibody (Catalog # MAB701) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands for Ubiquitin and Ubiquitin+1 were detected at approximately 11 kDa and 13 kDa, respectively (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 9.Applications for Human Ubiquitin/Ubiquitin+1 Antibody (83406)
Application
Recommended Usage
Immunohistochemistry
8-25 µg/mL
Sample: Immersion fixed paraffin-embedded sections of human Alzheimer's disease brain (cortex)
Sample: Immersion fixed paraffin-embedded sections of human Alzheimer's disease brain (cortex)
Western Blot
1-2 µg/mL
Sample: Recombinant Human Ubiquitin (Catalog # 701-UB)
Sample: Recombinant Human Ubiquitin (Catalog # 701-UB)
Reviewed Applications
Read 1 review rated 4 using MAB701 in the following applications:
Formulation, Preparation, and Storage
Purification
Protein A or G purified from hybridoma culture supernatant
Reconstitution
Reconstitute at 0.5 mg/mL in sterile PBS. For liquid material, refer to CoA for concentration.
Loading...
Formulation
Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 µm filtered solution in PBS.
Shipping
Lyophilized product is shipped at ambient temperature. Liquid small pack size (-SP) is shipped with polar packs. Upon receipt, store immediately at the temperature recommended below.
Stability & Storage
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
- 12 months from date of receipt, -20 to -70 °C as supplied.
- 1 month, 2 to 8 °C under sterile conditions after reconstitution.
- 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Calculators
Background: Ubiquitin/Ubiquitin+1
Long Name
frame shift mutant
Alternate Names
HEL-S-50, UBB
Gene Symbol
UBB
Additional Ubiquitin/Ubiquitin+1 Products
Product Documents for Human Ubiquitin/Ubiquitin+1 Antibody (83406)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Note: Certificate of Analysis not available for kit components.
Product Specific Notices for Human Ubiquitin/Ubiquitin+1 Antibody (83406)
For research use only
Related Research Areas
Citations for Human Ubiquitin/Ubiquitin+1 Antibody (83406)
Customer Reviews for Human Ubiquitin/Ubiquitin+1 Antibody (83406) (1)
4 out of 5
1 Customer Rating
Have you used Human Ubiquitin/Ubiquitin+1 Antibody (83406)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: See PMID 21505015Species: HumanVerified Customer | Posted 02/25/2015
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...